Description
LL-37 (5mg) Peptide
LL-37 (5mg) Peptide for sale online at Peptides Link Laboratory.
Buy LL-37, a human antimicrobial peptide from the cathelicidin family, noted for its extensive action and immunomodulatory properties. LL-37 peptide, a crucial element of the innate immune system, has attracted interest in antimicrobial research, immune response analysis, and studies on wound healing and inflammatory modulation. This study review emphasizes molecular properties and contemporary scientific findings, tailored for clarity and search engine relevance in peptide science.
Investigated for its antimicrobial and immunomodulatory effects, LL-37 is expressed in neutrophils, epithelial cells, and immune cells, playing a key role in innate immunity. Thus, research focuses on its interactions with microbial membranes, neutralization of endotoxins, and regulation of inflammatory pathways, making it a valuable tool for studying infectious diseases, wound healing, and immune regulation PMC, LL-37 Antimicrobial Activity. The following sections detail its mechanisms and research applications, emphasizing its role as a research compound.
Chemical Properties of LL-37 (5mg) Peptide
| Characteristic | Details |
|---|---|
| Chemical Sequence of Amino Acids | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRT |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4,493.32 g/mol: |
| Other Known Titles | Cathelicidin, hCAP18, CRAMP (Cationic Antimicrobial Peptide) |
Benefits and Uses Buy LL-37 Peptide
LL-37 is a remarkable antimicrobial peptide renowned for its diverse health benefits. Specifically, this peptide plays a crucial role as an immunity booster, enhancing your body’s defense against infections and diseases. Additionally, research studies have shown that LL-37 promotes wound healing, making it a valuable addition to skincare regimens. For those looking to buy LL-37 peptide, you’ll find various affordable LL-37 supplements available online, making it easy to incorporate this powerful compound into your healthcare routine.
Possible Side Effects and Precautions of LL-37
While there are numerous LL-37 health benefits, it’s important to consider potential side effects. As with any peptide, individual responses can vary; some users may experience mild irritation or allergic reactions. Therefore, it’s advisable to check LL-37 peptide reviews and consult with a healthcare provider before making an LL-37 injection purchase. For those seeking natural LL-37 alternatives, ensure to evaluate your options thoroughly to find the best place to buy LL-37 safely, whether for skincare or immune support.
Molecular Attributes of LL-37
The LL-37 peptide comprises 37 amino acids, commencing with two leucines (LL), which accounts for its designation. The amphipathic α-helical shape facilitates robust contact with microbial membranes, compromising pathogen integrity and simultaneously interacting with host cell receptors. The peptide possesses a cationic nature, facilitating electrostatic attraction to negatively charged bacterial cell walls, fungi, and viruses. In addition to its direct antibacterial properties, LL-37 affects chemotaxis, cytokine secretion, and cellular signaling pathways, establishing it as a multifunctional molecule in the study of peptide therapies and innate defense mechanisms.
Contemporary Research and Study Trends of LL-37
Recent studies investigate the LL-37 peptide across diverse experimental frameworks. Research on antimicrobial resistance assesses LL-37’s efficacy against drug-resistant bacteria and biofilms. Immunological investigations examine the modulation of inflammatory responses, wound healing, and tissue regeneration by LL‑37. Also, In cancer biology, researchers investigate LL‑37’s dual function in tumor microenvironments, with certain studies correlating expression levels to tumor development or inhibition. Synthetic analogs and delivery technologies for LL-37 are being developed to enhance stability and target specificity in laboratory models.
In conclusion, The LL‑37 peptide is a significant subject in molecular biology and peptide research because of its distinctive structure and many biological roles. Current research is enhancing comprehension of its function in innate immunity and prospective uses in antibacterial approaches and medicinal advancements.








Reviews
There are no reviews yet.